MMP-9 Picoband polyclonal, anti-mouse, rat
€455.00
In stock
SKU
AC-ABO11626
Catalog Number: AC-ABO11626
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, IHC-P in Mouse;Rat.Protein Name: Matrix metalloproteinase-9
Protein Function:
Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments (By similarity). .
Other Names: Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, Mmp9
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Gene ID: 81687
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.
Calculated MW: 78611
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments (By similarity). .
Other Names: Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, Mmp9
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Gene ID: 81687
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.
Calculated MW: 78611
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review