MMP-9 polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12354
Catalog Number: AC-ABO12354
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, E
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, ELISA in Human.Protein Name: Matrix metalloproteinase-9
Protein Function:
May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. .
Other Names: Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, MMP9, CLG4B
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Tissue Specificity: Produced by normal alveolar macrophages and granulocytes.
Gene ID: 4318
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.
Calculated MW: 78458
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. .
Other Names: Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, MMP9, CLG4B
Subcellular Localization: Secreted, extracellular space, extracellular matrix .
Tissue Specificity: Produced by normal alveolar macrophages and granulocytes.
Gene ID: 4318
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.
Calculated MW: 78458
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review