MMP10 polyclonal, anti-human

Quantity: 100 µg

Background:
Stromelysin-2 also known as matrix metalloproteinase-10 (MMP-10) or transin-2 is an enzyme that in humans is encoded by the MMP10 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

Description:
Rabbit IgG polyclonal antibody for Stromelysin-2 (MMP10) detection. Tested with WB in Human.

Synonyms:
Matrix metallopeptidase 10 (stromelysin 2) antibody, Matrix metalloprotease 10 antibody, Matrix metalloproteinase 10 (stromelysin 2) antibody, Matrix metalloproteinase 10 antibody, Matrix metalloproteinase-10 antibody, MMP 10 antibody, MMP-10 antibody, Mmp10 antibody, MMP10_HUMAN antibody, SL 2 antibody, SL-2 antibody, SL2 antibody, STMY 2 antibody, STMY2 antibody, Stromelysin 2 antibody, Stromelysin II antibody, Stromelysin-2 antibody, Stromelysin2 antibody, StromelysinII antibody, Transin 2 antibody, Transin-2 antibody, Transin2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human MMP10 (409-443aa RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF), different from the related mouse sequence by twelve amino acids, and from the related rat sequence by nine amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.