MMP3 polyclonal, anti-human

Quantity: 100 µg

Background:
Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Description:
Rabbit IgG polyclonal antibody for Stromelysin-1 (MMP3) detection. Tested with WB in Human.

Synonyms:
CHDS6 antibody, Matrix metalloproteinase 3 antibody, Matrix metalloproteinase 3 preproprotein antibody, Matrix metalloproteinase-3 antibody, MGC126102 antibody, MGC126103 antibody, MGC126104 antibody, MMP 3 antibody, MMP-3 antibody, MMP3 antibody, MMP3_HUMAN antibody, Progelatinase antibody, Proteoglycanase antibody, SL 1 antibody, SL-1 antibody, SL1 antibody, STMY antibody, STMY1 antibody, STR1 antibody, Stromelisin 1 antibody, Stromelysin 1 antibody, Stromelysin 1 progelatinase antibody, Stromelysin-1 antibody, Transin 1 antibody, Transin-1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.