MMP8 polyclonal, anti-mouse, rat

Quantity: 100 µg

Background:
MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

Description:
Rabbit IgG polyclonal antibody for Neutrophil collagenase (MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse, Rat.

Synonyms:
CLG 1 antibody, CLG1 antibody, Collagenase 1 antibody, Collagenase 1 neutrophil antibody, HNC antibody, Matrix metallopeptidase 8 (neutrophil collagenase) antibody, Matrix metalloprotease 8 antibody, Matrix metalloproteinase-8 antibody, MMP 8 antibody, MMP-8 antibody, Mmp8 antibody, MMP8_HUMAN antibody, Neutrophil collagenase antibody, PMNL CL antibody, PMNL collagenase antibody, PMNL-CL antibody, PMNLCL antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat

Applications: WB, IHC-P, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.