MMP9 polyclonal, anti-human

Quantity: 100 µg

Background:
Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Description:
Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9 (MMP9) detection. Tested with WB, ELISA in Human.

Synonyms:
82 kDa matrix metalloproteinase-9 antibody, 92 kDa gelatinase antibody, 92 kDa type IV collagenase antibody, CLG 4B antibody, CLG4B antibody, Collagenase Type 4 beta antibody, Collagenase type IV 92 KD antibody, EC 3.4.24.35 antibody, Gelatinase 92 KD antibody, Gelatinase B antibody, Gelatinase beta antibody, GelatinaseB antibody, GELB antibody, Macrophage gelatinase antibody, MANDP2 antibody, Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) antibody, Matrix Metalloproteinase 9 antibody, MMP 9 antibody, MMP-9 antibody, MMP9 antibody, MMP9_HUMAN antibody, Type V collagenase antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human MMP9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.