MRP1 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12895
Catalog Number: AC-ABO12895
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.
Protein Function:
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o- glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency. .
Other Names: Multidrug resistance-associated protein 1, ATP-binding cassette sub-family C member 1, Leukotriene C(4) transporter, LTC4 transporter, ABCC1, MRP, MRP1
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Lung, testis and peripheral blood mononuclear cells.
Gene ID: 4363
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Calculated MW: 171591
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o- glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency. .
Other Names: Multidrug resistance-associated protein 1, ATP-binding cassette sub-family C member 1, Leukotriene C(4) transporter, LTC4 transporter, ABCC1, MRP, MRP1
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Lung, testis and peripheral blood mononuclear cells.
Gene ID: 4363
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Calculated MW: 171591
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review