MUC2 polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12934
Catalog Number: AC-ABO12934
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for MUC2 detection. Tested with IHC-P in Human;Mouse;Rat.
Protein Function:
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Other Names: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC
Subcellular Localization: Secreted. In the intestine, secreted into the inner and outer mucus layers.
Tissue Specificity: Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.
Gene ID: 4583
Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
Calculated MW: 550850
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Other Names: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC
Subcellular Localization: Secreted. In the intestine, secreted into the inner and outer mucus layers.
Tissue Specificity: Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.
Gene ID: 4583
Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
Calculated MW: 550850
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review