Munc18-1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

Description:
Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1 (STXBP1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
FLJ37475 antibody, Munc 18 1 antibody, Munc 18a antibody, MUNC18 1 antibody, N-Sec1 antibody, Neuronal SEC1 antibody, NSec1 antibody, p67 antibody, Protein unc-18 homolog 1 antibody, Protein unc-18 homolog A antibody, Rb sec1 antibody, RBSEC1 antibody, STXB1_HUMAN antibody, STXBP1 antibody, Syntaxin binding protein 1 antibody, Syntaxin-binding protein 1 antibody, Unc 18 homolog antibody, Unc 18A antibody, Unc-18A antibody, Unc18 1 antibody, UNC18 antibody, Unc18-1 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.