NARG1 Picoband polyclonal, anti-human, mouse
€455.00
In stock
SKU
AC-ABO10319
Catalog Number: AC-ABO10319
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Tested with WB, IHC-P in Human;Mouse.Protein Name: N-alpha-acetyltransferase 15, NatA auxiliary subunit
Protein Function:
Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. .
Other Names: N-alpha-acetyltransferase 15, NatA auxiliary subunit, Gastric cancer antigen Ga19, N-terminal acetyltransferase, NMDA receptor-regulated protein 1, Protein tubedown-1, Tbdn100, NAA15, GA19, NARG1, NATH, TBDN100
Subcellular Localization: Cytoplasm. Nucleus. Mainly cytoplasmic, nuclear in some cases. Present in the free cytosolic and cytoskeleton-bound polysomes, but not in the membrane-bound polysomes.
Tissue Specificity: Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary glands, lung, ovary, urogenital system and upper gastrointestinal tract. Overexpressed in gastric cancer, in papillary thyroid carcinomas and in a Burkitt lymphoma cell line (Daudi). Specifically suppressed in abnormal proliferating blood vessels in eyes of patients with proliferative diabetic retinopathy. .
Gene ID: 80155
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
Calculated MW: 101272
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. .
Other Names: N-alpha-acetyltransferase 15, NatA auxiliary subunit, Gastric cancer antigen Ga19, N-terminal acetyltransferase, NMDA receptor-regulated protein 1, Protein tubedown-1, Tbdn100, NAA15, GA19, NARG1, NATH, TBDN100
Subcellular Localization: Cytoplasm. Nucleus. Mainly cytoplasmic, nuclear in some cases. Present in the free cytosolic and cytoskeleton-bound polysomes, but not in the membrane-bound polysomes.
Tissue Specificity: Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary glands, lung, ovary, urogenital system and upper gastrointestinal tract. Overexpressed in gastric cancer, in papillary thyroid carcinomas and in a Burkitt lymphoma cell line (Daudi). Specifically suppressed in abnormal proliferating blood vessels in eyes of patients with proliferative diabetic retinopathy. .
Gene ID: 80155
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
Calculated MW: 101272
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review