Neuropeptide Y Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11987
Catalog Number: AC-ABO11987
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Pro-neuropeptide Y
Protein Function:
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Other Names: Pro-neuropeptide Y, Neuropeptide Y, Neuropeptide tyrosine, NPY, C-flanking peptide of NPY, CPON, NPY
Subcellular Localization: Secreted.
Tissue Specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Gene ID: 4852
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.
Calculated MW: 10851
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Other Names: Pro-neuropeptide Y, Neuropeptide Y, Neuropeptide tyrosine, NPY, C-flanking peptide of NPY, CPON, NPY
Subcellular Localization: Secreted.
Tissue Specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Gene ID: 4852
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.
Calculated MW: 10851
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review