Neuroserpin polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Description:
Rabbit IgG polyclonal antibody for Neuroserpin (SERPINI1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
DKFZp781N13156 antibody, Neuroserpin antibody, NEUS_HUMAN antibody, Peptidase inhibitor 12 antibody, PI-12 antibody, PI12 antibody, Protease inhibitor 12 antibody, Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody, Serine or cysteine proteinase inhibitor clade I member 1 antibody, Serpin I1 antibody, Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody, SERPINI1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.