NIRF Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12592
Catalog Number: AC-ABO12592
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: E3 ubiquitin-protein ligase UHRF2
Protein Function:
E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. E3 SUMO-, but not ubiquitin-, protein ligase for ZNF131. .
Other Names: E3 ubiquitin-protein ligase UHRF2, 2.3.2.27, Np95/ICBP90-like RING finger protein, Np95-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, RING-type E3 ubiquitin transferase UHRF2, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquitin-like-containing PHD and RING finger domains protein 2, UHRF2, NIRF, RNF107
Subcellular Localization: Nucleus . Enriched at pericentric heterochromatin (PH). This localization is dependent on the interaction with H3K9me3 (By similarity). .
Gene ID: 115426
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
Calculated MW: 89985
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. E3 SUMO-, but not ubiquitin-, protein ligase for ZNF131. .
Other Names: E3 ubiquitin-protein ligase UHRF2, 2.3.2.27, Np95/ICBP90-like RING finger protein, Np95-like RING finger protein, Nuclear protein 97, Nuclear zinc finger protein Np97, RING finger protein 107, RING-type E3 ubiquitin transferase UHRF2, Ubiquitin-like PHD and RING finger domain-containing protein 2, Ubiquitin-like-containing PHD and RING finger domains protein 2, UHRF2, NIRF, RNF107
Subcellular Localization: Nucleus . Enriched at pericentric heterochromatin (PH). This localization is dependent on the interaction with H3K9me3 (By similarity). .
Gene ID: 115426
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
Calculated MW: 89985
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review