NIRF polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Description:
Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2 (UHRF2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
DKFZp434B0920 antibody, DKFZp686G0837 antibody, E3 ubiquitin-protein ligase UHRF2 antibody, MGC33463 antibody, Np95 like RING finger protein antibody, Np95-like ring finger protein antibody, Np95/ICBP90 like RING finger protein antibody, Np95/ICBP90-like RING finger protein antibody, Nuclear protein 97 antibody, Nuclear zinc finger protein Np97 antibody, RING finger protein 107 antibody, RNF 107 antibody, RP11-472F14.2 antibody, Ubiquitin like containing PHD and RING finger domains protein 2 antibody, Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody, Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody, Uhrf2 antibody, UHRF2_HUMAN antibody, URF 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.