nmt55/p54nrb polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 

Description:
Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein (NONO) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
52 kDa subunit antibody, 54 kDa nuclear RNA and DNA binding protein antibody, 54 kDa nuclear RNA- and DNA-binding protein antibody, 55 kDa nuclear protein antibody, DNA binding p52/p100 complex 52 kDa subunit antibody, DNA-binding p52/p100 complex antibody, NMT 55 antibody, NMT55 antibody, Non Pou domain containing octamer (ATGCAAAT) binding protein antibody, Non POU domain containing octamer binding antibody, Non POU domain containing octamer binding protein antibody, Non-POU domain-containing octamer-binding protein antibody, Nono antibody, NonO protein antibody, NONO_HUMAN antibody, NRB 54 antibody, NRB antibody, NRB54 antibody, Nuclear RNA binding protein 54kD antibody, P54 antibody, p54(nrb) antibody, p54nrb antibody, PPP1R114 antibody, Protein phosphatase 1 regulatory subunit 114 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.