NQO1 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Description:
Rabbit IgG polyclonal antibody for NAD (P)H dehydrogenase [quinone] 1 (NQO1) detection. Tested with WB in Human, Rat.

Synonyms:
Azoreductase antibody, Cytochrome b 5 reductase antibody, DHQU antibody, DIA 4 antibody, DIA4 antibody, Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody, Diaphorase (NADH/NADPH) antibody, Diaphorase 4 antibody, Dioxin inducible 1 antibody, DT diaphorase antibody, DT-diaphorase antibody, DTD antibody, Menadione reductase antibody, NAD(P)H dehydrogenase [quinone] 1 antibody, NAD(P)H dehydrogenase quinone 1 antibody, NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody, NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody, NAD(P)H:menadione oxidoreductase 1 antibody, NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody, NAD(P)H:quinone oxidoreductase 1 antibody, NAD(P)H:quinone oxireductase antibody, NMOR 1 antibody, NMOR I antibody, NMOR1 antibody, NMORI antibody, NQO 1 antibody, NQO1 antibody, NQO1_HUMAN antibody, Phylloquinone reductase antibody, QR 1 antibody, QR1 antibody, Quinone reductase 1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.