NUR77 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
NR4A1 (NUCLEAR RECEPTOR SUBFAMILY 4, GROUP A, MEMBER 1), also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, which is also a member of the Nur nuclear receptor family of intracellular transcription factors. The NR4A1 gene is mapped on 12q13.13. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.

Description:
Rabbit IgG polyclonal antibody for Nuclear receptor subfamily 4 group A member 1 (NR4A1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Early response protein NAK1 antibody, GFRP 1 antibody, GFRP antibody, GFRP1 antibody, Growth factor inducible nuclear protein N10 antibody, Growth Factor Inducible Nuclear Protein NP10 antibody, Growth Factor Response Protein 1 antibody, Hbr1 antibody, HMR antibody, Hormone Receptor antibody, MGC9485 antibody, N10 antibody, N10 nuclear protein antibody, NAK 1 antibody, NAK1 antibody, Nerve growth factor IB nuclear receptor variant 1 antibody, NGFIB antibody, NP 10 antibody, NP10 antibody, NR4A1 antibody, NR4A1_HUMAN antibody, Nuclear hormone receptor NUR/77 antibody, Nuclear Hormone Receptor TR3 antibody, Nuclear Receptor Subfamily 4 Group A Member 1 antibody, NUR 77 antibody, NUR77 antibody, Orphan nuclear receptor HMR antibody, Orphan nuclear receptor NR4A1 antibody, Orphan nuclear receptor TR3 antibody, ST 59 antibody, ST-59 antibody, ST59 antibody, Steroid receptor TR3 antibody, Testicular receptor 3 antibody, TR 3 antibody, TR3 antibody, TR3 orphan receptor antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human NUR77 (372-408aa HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.