OGT polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
FLJ23071 antibody, GlcNAc transferase antibody, HRNT1 antibody, MGC22921 antibody, O GlcNAc antibody, O GlcNAc transferase p110 subunit antibody, O GlcNAc transferase subunit p110 antibody, O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine: polypeptide N acetylglucosaminyl transferase) antibody, O linked N acetylglucosamine (GlcNAc) transferase antibody, O linked N acetylglucosamine transferase 110 kDa subunit antibody, O-GlcNAc transferase subunit p110 antibody, O-linked N-acetylglucosamine transferase 110 kDa subunit antibody, ogt antibody, OGT1_HUMAN antibody, UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit antibody, UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase antibody, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit antibody, UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase antibody, Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.