OPG polyclonal, anti-human, mouse, rat antibody
€270.00
In stock
SKU
AC-ABO11425
Description: Rabbit IgG polyclonal antibody for Kininogen-1 (KNG1) detection. Tested with WB, IHC-P in Mouse.
Protein Name: Kininogen-1
Background:
(1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting (By similarity). .
Other Names:
Kininogen-1, Kininogen-1 heavy chain, Bradykinin, Kininogen-1 light chain, Kng1, Kng
Subcellular Localization: Secreted, extracellular space.
Tissue Specificity: Plasma.
Gene ID: 16644
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
Calculated MW: 73102
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Kininogen-1
Background:
(1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting (By similarity). .
Other Names:
Kininogen-1, Kininogen-1 heavy chain, Bradykinin, Kininogen-1 light chain, Kng1, Kng
Subcellular Localization: Secreted, extracellular space.
Tissue Specificity: Plasma.
Gene ID: 16644
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
Calculated MW: 73102
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review