Osteopontin polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Osteopontin (SPP1) detection. Tested with WB, ELISA in Human, Mouse, Rat.

Synonyms:
BNSP antibody, Bone sialoprotein 1 antibody, BSP I antibody, BSPI antibody, Early T lymphocyte activation 1 antibody, ETA 1 antibody, ETA1 antibody, MGC110940 antibody, Nephropontin antibody, OPN antibody, Osteopontin antibody, osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody, OSTP_HUMAN antibody, PSEC0156 antibody, secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody, Secreted phosphoprotein 1 antibody, SPP 1 antibody, SPP-1 antibody, SPP1 antibody, SPP1/CALPHA1 fusion antibody, Urinary stone protein antibody, Uropontin antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, ELISA

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.