Otoferlin polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Otoferlin (OTOF) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
AUNB1 antibody, Deafness, autosomal recessive 9 antibody, DFNB6 antibody, DFNB9 antibody, Fer 1 like protein 2 antibody, Fer-1-like protein 2 antibody, FER1L2 antibody, NSRD9 antibody, Otof antibody, OTOF_HUMAN antibody, Otoferlin antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.