P GlycoProtein polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12719
Catalog Number: AC-ABO12719
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P, IHC-F
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P, IHC-F
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat.Protein Name: Multidrug resistance protein 1
Protein Function:
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Other Names: Multidrug resistance protein 1, 3.6.3.44, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Expressed in liver, kidney, small intestine and brain.
Gene ID: 5243
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Calculated MW: 141479
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Other Names: Multidrug resistance protein 1, 3.6.3.44, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1
Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
Tissue Specificity: Expressed in liver, kidney, small intestine and brain.
Gene ID: 5243
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
Calculated MW: 141479
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review