P-Selectin human active recombinant protein

Protein Family: Cell Adhesion Molecules, Cellular Antigens, CAM Ligands

Pathway and Disease: Signaling Molecules and Interaction

Alternate Names: P-Selectin, P-SEL, Platelet Alpha-Granule Membrane Protein, CD62, CD62P, Granulocyte Membrane Protein GRMP, GMP140, LECAM-3.Description:
P-selectin belongs to a family of divalent cation dependent carbohydrate-binding glycoproteins or adhesion molecules. P-selectin is expressed transiently on the surface of activated platelets and endothelial cells. Secreted P-selectin is thought to play a key role in the adhesion of platelets to monocytes and neutrophils during an inflammatory response. Levels of P-selectin may be elevated in a number of pathological conditions. Recombinant human P-selectin comprises a 566 amino acid fragment (197-761) corresponding to the cysteine rich complement control protein domain and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: Q14242

MW: 65.3 kDa

Sequence:
His-Tag sequence not included: EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRA

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.