p95 NBS1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).

Description:
Rabbit IgG polyclonal antibody for Nibrin (NBN) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
AT V1 antibody, AT V2 antibody, ATV antibody, ATV antibody, Cell cycle regulatory protein p95 antibody, FLJ10155 antibody, MGC87362 antibody, NBN antibody, NBN_HUMAN antibody, NBS 1 antibody, NBS antibody, NBS antibody, NBS1 antibody, Nibrin antibody, Nibrin antibody, Nijmegen breakage syndrome 1 (nibrin) antibody, Nijmegen breakage syndrome antibody, Nijmegen breakage syndrome protein 1 antibody, p95 antibody, p95 antibody, p95 protein of the MRE11/RAD50 complex antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.