PACE4 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12455
Catalog Number: AC-ABO12455
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human;Rat.Protein Name: Proprotein convertase subtilisin/kexin type 6
Protein Function:
Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.
Other Names: Proprotein convertase subtilisin/kexin type 6, 3.4.21.-, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, SPC4, Subtilisin/kexin-like protease PACE4, PCSK6, PACE4
Subcellular Localization: Isoform PACE4A-I: Secreted.
Tissue Specificity: Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.
Gene ID: 5046
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.
Calculated MW: 106420
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.
Other Names: Proprotein convertase subtilisin/kexin type 6, 3.4.21.-, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, SPC4, Subtilisin/kexin-like protease PACE4, PCSK6, PACE4
Subcellular Localization: Isoform PACE4A-I: Secreted.
Tissue Specificity: Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.
Gene ID: 5046
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.
Calculated MW: 106420
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review