PACE4 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

Description:
Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6 (PCSK6) detection. Tested with WB in Human, Rat.

Synonyms:
Paired basic amino acid cleaving enzyme 4 antibody, Paired basic amino acid cleaving system 4 antibody, PCSK6 antibody, PCSK6_HUMAN antibody, Proprotein convertase subtilisin/kexin type 6 antibody, SPC4 antibody, Subtilisin like protease antibody, Subtilisin-like proprotein convertase 4 antibody, subtilisin/kexin like protease PACE4 antibody, Subtilisin/kexin-like protease PACE4 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.