PAK5 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12419
Catalog Number: AC-ABO12419
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7(PAK7) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Serine/threonine-protein kinase PAK 7
Protein Function:
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions. .
Other Names: Serine/threonine-protein kinase PAK 5, 2.7.11.1, p21-activated kinase 5, PAK-5, p21-activated kinase 7, PAK-7, PAK5 (HGNC:15916), KIAA1264, PAK7
Subcellular Localization: Mitochondrion. Cytoplasm. Nucleus. Shuttles between the nucleus and the mitochondria, and mitochondrial localization is essential for the role in cell survival.
Tissue Specificity: Predominantly expressed in brain.
Gene ID: 57144
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.
Calculated MW: 80745
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions. .
Other Names: Serine/threonine-protein kinase PAK 5, 2.7.11.1, p21-activated kinase 5, PAK-5, p21-activated kinase 7, PAK-7, PAK5 (HGNC:15916), KIAA1264, PAK7
Subcellular Localization: Mitochondrion. Cytoplasm. Nucleus. Shuttles between the nucleus and the mitochondria, and mitochondrial localization is essential for the role in cell survival.
Tissue Specificity: Predominantly expressed in brain.
Gene ID: 57144
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.
Calculated MW: 80745
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review