PAK5 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Serine/threonine-protein kinase PAK 7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Description:
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7 (PAK7) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
EC 2.7.11.1 antibody, KIAA1264 antibody, MGC26232 antibody, p21 activated kinase 7 antibody, p21 protein (Cdc42/Rac)-activated kinase 7 antibody, p21(CDKN1A) activated kinase 7 antibody, p21-activated kinase 5 antibody, p21-activated kinase 7 antibody, PAK 5 antibody, PAK 7 antibody, PAK-5 antibody, PAK-7 antibody, PAK5 antibody, PAK7 antibody, PAK7_HUMAN antibody, Protein kinase PAK5 antibody, Serine/threonine protein kinase PAK 7 antibody, Serine/threonine-protein kinase PAK 7 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.