PAR2 polyclonal, anti-human

Quantity: 100 µg

Background:
Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.

Description:
Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2 (F2RL1) detection. Tested with WB in Human.

Synonyms:
Coagulation factor II receptor like 1 antibody, Coagulation factor II receptor-like 1 antibody, Coagulation factor II thrombin receptor like 1 antibody, F2RL1 antibody, G protein coupled receptor 11 antibody, G-protein coupled receptor 11 antibody, GPR11 antibody, PAR 2 antibody, PAR-2 antibody, PAR2_HUMAN antibody, Protease activated receptor 2 antibody, Proteinase activated receptor 2 antibody, Proteinase-activated receptor 2 antibody, Thrombin receptor like 1 antibody, Thrombin receptor-like 1 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.