Parvin alpha polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Description:
Rabbit IgG polyclonal antibody for Alpha-parvin (PARVA) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Actopaxin antibody, Alpha parvin antibody, Alpha-parvin antibody, Calponin like integrin linked kinase binding protein antibody, Calponin-like integrin-linked kinase-binding protein antibody, CH ILKBP antibody, CH-ILKBP antibody, FLJ10793 antibody, FLJ12254 antibody, Matrix remodelling associated 2 antibody, Matrix remodelling associated protein 2 antibody, Matrix-remodeling-associated protein 2 antibody, MXRA 2 antibody, MXRA2 antibody, PARV A antibody, PARVA antibody, PARVA_HUMAN antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.