PAX8 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10128
Catalog Number: AC-ABO10128
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for PAX8 detection. Tested with WB in Human;Mouse;Rat.
Protein Function:
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Other Names: Paired box protein Pax-8, PAX8
Subcellular Localization: Nucleus.
Tissue Specificity: Expressed in the excretory system, thyroid gland and Wilms tumors.
Gene ID: 7849
Immunogen: A synthetic peptide corresponding to a sequence of human PAX8 (RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ).
Calculated MW: 48218
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
Protein Function:
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Other Names: Paired box protein Pax-8, PAX8
Subcellular Localization: Nucleus.
Tissue Specificity: Expressed in the excretory system, thyroid gland and Wilms tumors.
Gene ID: 7849
Immunogen: A synthetic peptide corresponding to a sequence of human PAX8 (RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ).
Calculated MW: 48218
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review