PDGF-1 human active recombinant protein

Protein Family: CAM Ligands

Pathway and Disease: Signaling Molecules and Interaction, Cell Motility, Cell Communication, Cancers

Alternate Names: PDGF1, Platelet derived growth factor A, PDGF1, platelet derived growth factor alphaDescription:
The term ‘PDGF’ refers to a family of disulphide bond linked dimeric isoforms that act as autocrine and paracrine growth factors and are released by platelets. They act as potent mitogens for almost all mesenchymally-derived cells. Aberrant expression is involved in certain cancers, fibroproliferative disorders, and atherosclerosis. PDGF proteins also contribute to wound healing and neural regeneration. There are four members of the PDGF family – PDGF A, PDGF B, PDGF C and PDGF D. PDGF-A is expressed as a short form that is soluble and a long form that is retained by the extracellular matrix. Recombinant PDGF-A comprises a 110 amino acid fragment (87-196) corresponding to the mature PDGF-A short chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P04085

MW: 17.02 kDa

Sequence:
His-Tag sequence not included: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.