PDK4 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Pyruvate dehydrogenase lipoamide kinase isozyme 4, mitochondrial is an enzyme that in humans is encoded by the PDK4 gene. This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. In addition, PDK4 is increased in hibernation and helps to decrease metabolism and conserve glucose by decreasing its conversion to acetyl-CoA, which enters the citric acid cycle and is converted to ATP.

Description:
Rabbit IgG polyclonal antibody for [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial (PDK4) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4 antibody, FLJ40832 antibody, mitochondrial antibody, Pdk4 antibody, PDK4_HUMAN antibody, Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial antibody, Pyruvate dehydrogenase kinase 4 antibody, Pyruvate dehydrogenase kinase isoenzyme 4 antibody, Pyruvate dehydrogenase kinase isoform 4 antibody, Pyruvate dehydrogenase kinase isozyme 4 antibody, Pyruvate dehydrogenase kinase isozyme 4 mitochondrial antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.