PDPK1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
3-phosphoinositide dependent protein kinase-1, also known as PDPK1, is a protein which in humans is encoded by the PDPK1 gene. It is mapped to 16p13.3. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.

Description:
Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1 (PDPK1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
3 phosphoinositide dependent protein kinase 1 antibody, 3-phosphoinositide-dependent protein kinase 1 antibody, hPDK 1 antibody, hPDK1 antibody, MGC20087 antibody, MGC35290 antibody, OTTHUMP00000159109 antibody, OTTHUMP00000159110 antibody, OTTHUMP00000174525 antibody, PDK1 antibody, Pdpk1 antibody, PDPK1_HUMAN antibody, PDPK2 antibody, PkB kinase antibody, PkB kinase like gene 1 antibody, PkB like 1 antibody, PRO0461 antibody, Protein kinase antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.