Pea3 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Description:
Rabbit IgG polyclonal antibody for ETS translocation variant 4 (ETV4) detection. Tested with WB in Human, Rat.

Synonyms:
Adenovirus E1A enhancer binding protein antibody, Adenovirus E1A enhancer-binding protein antibody, E1A F antibody, E1A-F antibody, ETS translocation variant 4 antibody, ets variant gene 4 (E1A enhancer binding protein E1AF) antibody, ETV4 antibody, ETV4_HUMAN antibody, PEA3 antibody, PEA3 protein antibody, PEAS3 antibody, Polyomavirus enhancer activator 3 antibody, Polyomavirus enhancer activator 3 homolog antibody, Protein PEA3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.