Periplakin Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10228
Catalog Number: AC-ABO10228
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Periplakin(PPL) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Periplakin
Protein Function:
Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling. .
Other Names: Periplakin, 190 kDa paraneoplastic pemphigus antigen, 195 kDa cornified envelope precursor protein, PPL, KIAA0568
Subcellular Localization: Cell junction, desmosome . Cytoplasm, cytoskeleton . Cell membrane . Nucleus . Mitochondrion . Associated with desmosomes and intermediate filaments.
Tissue Specificity: Expressed in stratified squamous epithelia and in some other epithelia. .
Gene ID: 5493
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
Calculated MW: 204747
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling. .
Other Names: Periplakin, 190 kDa paraneoplastic pemphigus antigen, 195 kDa cornified envelope precursor protein, PPL, KIAA0568
Subcellular Localization: Cell junction, desmosome . Cytoplasm, cytoskeleton . Cell membrane . Nucleus . Mitochondrion . Associated with desmosomes and intermediate filaments.
Tissue Specificity: Expressed in stratified squamous epithelia and in some other epithelia. .
Gene ID: 5493
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
Calculated MW: 204747
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review