Peroxiredoxin 4 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

Description:
Rabbit IgG polyclonal antibody for Peroxiredoxin-4 (PRDX4) detection. Tested with WB, IHC-P, ICC in Human, Mouse, Rat.

Synonyms:
Antioxidant enzyme 372 antibody, Antioxidant enzyme AOE372 antibody, AOE37 2 antibody, AOE37-2 antibody, AOE372 antibody, EC 1.11.1.15 antibody, Peroxiredoxin IV antibody, Peroxiredoxin-4 antibody, Peroxiredoxin4 antibody, PRDX 4 antibody, PRDX4 antibody, PRDX4_HUMAN antibody, PRX 4 antibody, Prx IV antibody, Prx-IV antibody, PRX4 antibody, PrxIV antibody, Thioredoxin dependent peroxide reductase A0372 antibody, Thioredoxin Peroxidase (Antioxidant Enzyme) antibody, Thioredoxin peroxidase antibody, Thioredoxin peroxidase AO372 antibody, Thioredoxin-dependent peroxide reductase A0372 antibody, TRANK antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P, ICC

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.