PGP9.5 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Description:
Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Neuron cytoplasmic protein 9.5 antibody, OTTHUMP00000218137 antibody, OTTHUMP00000218139 antibody, OTTHUMP00000218140 antibody, OTTHUMP00000218141 antibody, Park 5 antibody, PARK5 antibody, PGP 9.5 antibody, PGP9.5 antibody, PGP95 antibody, Protein gene product 9.5 antibody, Ubiquitin C terminal esterase L1 antibody, Ubiquitin C terminal hydrolase antibody, Ubiquitin carboxyl terminal esterase L1 antibody, Ubiquitin carboxyl terminal hydrolase isozyme L1 antibody, Ubiquitin carboxyl-terminal hydrolase isozyme L1 antibody, Ubiquitin thioesterase L1 antibody, Ubiquitin thiolesterase antibody, Ubiquitin thiolesterase L1 antibody, UCH-L1 antibody, UCHL1 antibody, UCHL1_HUMAN antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.