PIAS4 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11700
Catalog Number: AC-ABO11700
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human;Mouse;Rat.Protein Name: E3 SUMO-protein ligase PIAS4
Protein Function:
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. .
Other Names: E3 SUMO-protein ligase PIAS4, 2.3.2.27, PIASy, Protein inhibitor of activated STAT protein 4, Protein inhibitor of activated STAT protein gamma, PIAS-gamma, RING-type E3 ubiquitin transferase PIAS4, PIAS4, PIASG
Subcellular Localization: Nucleus, PML body . Colocalizes with SUMO1 and TCF7L2/TCF4 and LEF1 in a subset of PML (promyelocytic leukemia) nuclear bodies.
Tissue Specificity: Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. .
Gene ID: 51588
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.
Calculated MW: 56504
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. .
Other Names: E3 SUMO-protein ligase PIAS4, 2.3.2.27, PIASy, Protein inhibitor of activated STAT protein 4, Protein inhibitor of activated STAT protein gamma, PIAS-gamma, RING-type E3 ubiquitin transferase PIAS4, PIAS4, PIASG
Subcellular Localization: Nucleus, PML body . Colocalizes with SUMO1 and TCF7L2/TCF4 and LEF1 in a subset of PML (promyelocytic leukemia) nuclear bodies.
Tissue Specificity: Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. .
Gene ID: 51588
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.
Calculated MW: 56504
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review