PIGR polyclonal, anti-human

Quantity: 100 µg

Background:
Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.

Description:
Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor (PIGR) detection. Tested with WB in Human.

Synonyms:
Hepatocellular carcinoma associated protein TB6 antibody, Hepatocellular carcinoma-associated protein TB6 antibody, MGC125361 antibody, MGC125362 antibody, Phosphatidylinositol glycan, class R antibody, PIGR antibody, PIGR_HUMAN antibody, Poly Ig receptor antibody, Poly-Ig receptor antibody, Polymeric immunoglobulin receptor antibody, Secretory component antibody, Transmembrane secretory component antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.