PIM1 polyclonal, anti-human

Quantity: 100 µg

Background:
Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation.

Description:
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase pim-1 (PIM1) detection. Tested with WB in Human.

Synonyms:
Oncogene PIM 1 antibody, Oncogene PIM1 antibody, PIM 1 antibody, pim 1 kinase 44 kDa isoform antibody, Pim 1 kinase antibody, pim 1 oncogene (proviral integration site 1) antibody, Pim 1 oncogene antibody, PIM antibody, PIM1 antibody, pim1 kinase 44 kDa isoform antibody, PIM1_HUMAN antibody, Pim2 antibody, PIM3 antibody, Proto oncogene serine/threonine protein kinase Pim 1 antibody, Proto-oncogene serine/threonine-protein kinase Pim-1 antibody, Proviral integration site 1 antibody, Proviral integration site 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.