PKLR polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR (PKLR) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
EC 2.7.1.40 antibody, KPYR_HUMAN antibody, L-PK antibody, Pk-1 antibody, PK1 antibody, PKL antibody, Pklg antibody, Pklr antibody, PKR antibody, PKRL antibody, Pyruvate kinase 1 antibody, Pyruvate kinase isozymes R/L antibody, Pyruvate kinase liver and blood cell antibody, Pyruvate kinase liver and RBC antibody, Pyruvate kinase liver and red blood cell antibody, Pyruvate kinase liver type antibody, Pyruvate kinase type L antibody, Pyruvate kinase, red cell type antibody, R type/L type pyruvate kinase antibody, R-PK antibody, R-type/L-type pyruvate kinase antibody, Red cell/liver pyruvate kinase antibody, RPK antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.