PKR polyclonal, anti-human

Quantity: 100 µg

Background:
EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2), also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene. Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, the alpha subunit of eukaryotic protein synthesis initiation factor-2, leading to the inhibition of protein synthesis. By FISH analysis, Squire et al. (1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21. Ben-Asouli et al. (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield. IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region. Taylor et al. (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon. They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR. E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth.

Description:
Rabbit IgG polyclonal antibody for Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2) detection. Tested with WB in Human.

Synonyms:
double stranded RNA activated protein kinase; antibody, E2AK2_HUMAN antibody, eIF-2A protein kinase 2 antibody, EIF2AK1 antibody, EIF2AK2 antibody, Eukaryotic translation initiation factor 2 alpha kinase 2 antibody, Eukaryotic translation initiation factor 2-alpha kinase 2 antibody, eukaryotic translation initiation factor 2-alpha kinase antibody, HGNC:9437 antibody, Interferon induced double stranded RNA activated protein kinase antibody, Interferon inducible elF2 alpha kinase antibody, Interferon inducible RNA dependent protein kinase antibody, Interferon inducible RNA-dependent protein kinase antibody, Interferon-induced, double-stranded RNA-activated protein kinase antibody, Interferon-inducible RNA-dependent protein kinase antibody, MGC126524 antibody, P1/eIF-2A protein kinase antibody, P1/eIF2A protein kinase antibody, p68 kinase antibody, PKR antibody, PRKR antibody, Protein kinase interferon inducible double stranded RNA dependent antibody, Protein kinase RNA activated antibody, Protein kinase RNA-activated antibody, Serine/threonine protein kinase TIK antibody, Serine/threonine-protein kinase TIK antibody, Tyrosine protein kinase EIF2AK2 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.