PLA2G4A polyclonal, anti-human, mouse

Quantity: 100 µg

Background:
PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).

Description:
Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2 (PLA2G4A) detection. Tested with WB in Human, Mouse.

Synonyms:
Calcium dependent phospholipid binding protein antibody, CPLA 2 antibody, cPLA2 alpha antibody, cPLA2 antibody, Cytosolic phospholipase A2 antibody, Cytosolic phospholipase A2 group IVA antibody, Lysophospholipase antibody, MGC126350 antibody, PA24A_HUMAN antibody, Phosphatidylcholine 2 acylhydrolase antibody, Phosphatidylcholine 2-acylhydrolase antibody, Phospholipase A2 group 4 A antibody, Phospholipase A2 group IVA (cytosolic calcium dependent) antibody, Phospholipase A2 group IVA antibody, PhospholipaseA2 antibody, PLA2G4 antibody, pla2g4a antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.