POR Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12422
Catalog Number: AC-ABO12422
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: NADPH--cytochrome P450 reductase
Protein Function:
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
Other Names: NADPH--cytochrome P450 reductase {ECO:0000255|HAMAP-Rule:MF_03212}, CPR {ECO:0000255|HAMAP-Rule:MF_03212}, P450R {ECO:0000255|HAMAP-Rule:MF_03212}, 1.6.2.4 {ECO:0000255|HAMAP-Rule:MF_03212}, POR {ECO:0000255|HAMAP-Rule:MF_03212}, CYPOR
Subcellular Localization: Endoplasmic reticulum membrane; Peripheral membrane protein. Anchored to the ER membrane by its N- terminal hydrophobic region.
Gene ID: 5447
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Calculated MW: 76690
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
Other Names: NADPH--cytochrome P450 reductase {ECO:0000255|HAMAP-Rule:MF_03212}, CPR {ECO:0000255|HAMAP-Rule:MF_03212}, P450R {ECO:0000255|HAMAP-Rule:MF_03212}, 1.6.2.4 {ECO:0000255|HAMAP-Rule:MF_03212}, POR {ECO:0000255|HAMAP-Rule:MF_03212}, CYPOR
Subcellular Localization: Endoplasmic reticulum membrane; Peripheral membrane protein. Anchored to the ER membrane by its N- terminal hydrophobic region.
Gene ID: 5447
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Calculated MW: 76690
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review