POR polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Description:
Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase (POR) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
CPR antibody, CYPOR antibody, DKFZp686G04235 antibody, FLJ26468 antibody, NADPH Cytochrome P450 Reductase antibody, NADPH dependent cytochrome P450 reductase antibody, NADPH--cytochrome P450 reductase antibody, NCPR_HUMAN antibody, P450 (cytochrome) oxidoreductase antibody, P450 Cytochrome Oxidoreductase antibody, P450R antibody, POR antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.