PRLR polyclonal, anti-human

Quantity: 100 µg

Background:
PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.

Description:
Rabbit IgG polyclonal antibody for Prolactin receptor (PRLR) detection. Tested with WB in Human.

Synonyms:
AI987712 antibody, CLONE SPM213 antibody, CPRLP antibody, Delta 4-delta 7/11 truncated prolactin receptor antibody, Delta 4-SF1b truncated prolactin receptor antibody, hPRL receptor antibody, hPRLrI antibody, Lactogen receptor antibody, MGC105486 antibody, OPR antibody, OTTHUMP00000115998 antibody, Pr-1 antibody, Pr-3 antibody, PRL R antibody, PRL-R antibody, PRLR antibody, Prlr-rs1 antibody, PRLR_HUMAN antibody, Prolactin receptor a antibody, Prolactin receptor antibody, Prolactin receptor delta 7/11 antibody, RATPRLR antibody, Secreted prolactin binding protein antibody, Truncated testis-specific box 1-C prolactin receptor antibody, wu:fj65c07 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.