Prolactin human active recombinant protein

Protein Family: Hormones

Pathway and Disease: Endocrine System, Immune System, Development and Behavior

Alternate Names: Prolactin, PRLDescription:
Prolactin (PRL) is a neuroendocrine hormone synthesized primarily by the pituitary gland and a variety of other cell types including the placenta, brain and uterus. Its primary function is to promote and maintain lactation but has also been shown to have a role in breast cancer development, regulation of reproductive function, and immunoregulation. Recombinant prolactin comprises a 199 amino acid fragment (29-227) corresponding to the mature prolactin protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P01236

MW: 27.03 kDa

Sequence:
His-Tag sequence not included: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.