PSMA1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11705
Catalog Number: AC-ABO11705
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Proteasome subunit alpha type-1
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome (By similarity). Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells (By similarity). .
Other Names: Proteasome subunit alpha type-1, 3.4.25.1, 30 kDa prosomal protein, PROS-30, Macropain subunit C2, Multicatalytic endopeptidase complex subunit C2, Proteasome component C2, Proteasome nu chain, PSMA1, HC2, NU, PROS30, PSC2
Subcellular Localization: Cytoplasm. Nucleus.
Gene ID: 5682
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids
Calculated MW: 29556
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal transduction in the macrophage proteasome (By similarity). Might be involved in the anti-inflammatory response of macrophages during the interaction with C.albicans heat-inactivated cells (By similarity). .
Other Names: Proteasome subunit alpha type-1, 3.4.25.1, 30 kDa prosomal protein, PROS-30, Macropain subunit C2, Multicatalytic endopeptidase complex subunit C2, Proteasome component C2, Proteasome nu chain, PSMA1, HC2, NU, PROS30, PSC2
Subcellular Localization: Cytoplasm. Nucleus.
Gene ID: 5682
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids
Calculated MW: 29556
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review