PSMA2 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO11706
Catalog Number: AC-ABO11706
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human;Rat.Protein Name: Proteasome subunit alpha type-2
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.
Other Names: Proteasome subunit alpha type-2, 3.4.25.1, Macropain subunit C3, Multicatalytic endopeptidase complex subunit C3, Proteasome component C3, PSMA2, HC3, PSC3
Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, P-body . Colocalizes with TRIM5 in the cytoplasmic bodies. .
Gene ID: 5683
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.
Calculated MW: 25899
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.
Other Names: Proteasome subunit alpha type-2, 3.4.25.1, Macropain subunit C3, Multicatalytic endopeptidase complex subunit C3, Proteasome component C3, PSMA2, HC3, PSC3
Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, P-body . Colocalizes with TRIM5 in the cytoplasmic bodies. .
Gene ID: 5683
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.
Calculated MW: 25899
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review